| Product Number |
ARP41557_P050 |
| Product Page |
www.avivasysbio.com/cox6a1-antibody-c-terminal-region-arp41557-p050.html |
| Name |
Cox6a1 Antibody - C-terminal region (ARP41557_P050) |
| Protein Size (# AA) |
112 amino acids |
| Molecular Weight |
12kDa |
| Subunit |
6A1, mitochondrial |
| NCBI Gene Id |
12861 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytochrome c oxidase, subunit VI a, polypeptide 1 |
| Alias Symbols |
VIaL |
| Peptide Sequence |
Synthetic peptide located within the following region: FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
SNCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cox6a1 (ARP41557_P050) antibody |
| Blocking Peptide |
For anti-Cox6a1 (ARP41557_P050) antibody is Catalog # AAP41557 |
| Uniprot ID |
Q9DCW5 |
| Protein Name |
Cytochrome c oxidase subunit 6A, mitochondrial RuleBase RU004397 |
| Protein Accession # |
NP_031774 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007748 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Cox6a1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Cox6a1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
