Product Number |
ARP41504_T100 |
Product Page |
www.avivasysbio.com/ceacam6-antibody-middle-region-arp41504-t100.html |
Name |
CEACAM6 Antibody - middle region (ARP41504_T100) |
Protein Size (# AA) |
344 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
4680 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) |
Alias Symbols |
NCA, CEAL, CD66c |
Peptide Sequence |
Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Muenzner,P., (2005) J. Cell Biol. 170 (5), 825-836 |
Description of Target |
Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy. |
Protein Interactions |
CARTPT; CEACAM6; CEACAM8; CEACAM7; CEACAM5; CEACAM1; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CEACAM6 (ARP41504_T100) antibody |
Blocking Peptide |
For anti-CEACAM6 (ARP41504_T100) antibody is Catalog # AAP41504 (Previous Catalog # AAPS09602) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6 |
Uniprot ID |
P40199 |
Protein Name |
Carcinoembryonic antigen-related cell adhesion molecule 6 |
Publications |
Kobayashi, M. et al. Carcinoembryonic antigen-related cell adhesion molecules as surrogate markers for EGFR inhibitor sensitivity in human lung adenocarcinoma. Br. J. Cancer 107, 1745-53 (2012). 23099808 |
Protein Accession # |
NP_002474 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_002483 |
Tested Species Reactivity |
Human |
Gene Symbol |
CEACAM6 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CEACAM6 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Lung
| Rabbit Anti-CEACAM6 Antibody Catalog Number: ARP41504 Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Stomach Tumor, 293T Cell Lysate
| Host: Rabbit Target: CEACAM6 Positive control (+): Human Stomach Tumor (T-ST) Negative control (-): 293T Cell Lysate (2T) Antibody concentration: 0.5ug/ml |
|
Image 4 | Jurkat
| Host: Rabbit Target Name: CEACAM6 Sample Type: Jurkat Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1.25ug/mL Peptide Concentration: 1.0ug/mL Lysate Quantity: 25ug/lane Gel Concentration: 12% |
|