Product Number |
ARP41481_P050 |
Product Page |
www.avivasysbio.com/ctsd-antibody-c-terminal-region-arp41481-p050.html |
Name |
Ctsd Antibody - C-terminal region (ARP41481_P050) |
Protein Size (# AA) |
410 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
13033 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cathepsin D |
Alias Symbols |
CD, Cat, CatD |
Peptide Sequence |
Synthetic peptide located within the following region: KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Ctsd is an acid protease active in intracellular protein breakdown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Ctsd (ARP41481_P050) antibody |
Blocking Peptide |
For anti-Ctsd (ARP41481_P050) antibody is Catalog # AAP41481 (Previous Catalog # AAPS09403) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P18242 |
Protein Name |
Cathepsin D |
Publications |
The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions. J. Cell. Sci. 128, 3068-81 (2015). 26163492 |
Protein Accession # |
NP_034113 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009983 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
Ctsd |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 92%; Zebrafish: 92% |
Image 1 | Mouse Heart
| Host: Mouse Target Name: CTSD Sample Tissue: Mouse Heart Antibody Dilution: 1ug/ml |
| Image 2 | Human
| Primary dilution: 1ug/mL Secondary dilution: 2mg/mL |
| Image 3 | Human U937
| Lanes: 20 ug U937 cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:2000 Gene Name: Ctsd Submitted by: Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland
|
|
|