Ctsd Antibody - C-terminal region (ARP41481_P050)

Data Sheet
 
Product Number ARP41481_P050
Product Page www.avivasysbio.com/ctsd-antibody-c-terminal-region-arp41481-p050.html
Name Ctsd Antibody - C-terminal region (ARP41481_P050)
Protein Size (# AA) 410 amino acids
Molecular Weight 45kDa
NCBI Gene Id 13033
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cathepsin D
Alias Symbols CD, Cat, CatD
Peptide Sequence Synthetic peptide located within the following region: KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Ctsd is an acid protease active in intracellular protein breakdown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Ctsd (ARP41481_P050) antibody
Blocking Peptide For anti-Ctsd (ARP41481_P050) antibody is Catalog # AAP41481 (Previous Catalog # AAPS09403)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID P18242
Protein Name Cathepsin D
Publications

The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions. J. Cell. Sci. 128, 3068-81 (2015). 26163492

Protein Accession # NP_034113
Purification Affinity Purified
Nucleotide Accession # NM_009983
Tested Species Reactivity Human, Mouse
Gene Symbol Ctsd
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 92%; Zebrafish: 92%
Image 1
Mouse Heart
Host: Mouse
Target Name: CTSD
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml
Image 2
Human
Primary dilution: 1ug/mL
Secondary dilution: 2mg/mL
Image 3
Human U937
Lanes:
20 ug U937 cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
Ctsd
Submitted by:
Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com