| Product Number |
ARP41429_P050 |
| Product Page |
www.avivasysbio.com/pla2g5-antibody-middle-region-arp41429-p050.html |
| Name |
PLA2G5 Antibody - middle region (ARP41429_P050) |
| Protein Size (# AA) |
138 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
5322 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Phospholipase A2, group V |
| Alias Symbols |
FRFB, GV-PLA2, PLA2-10, hVPLA(2) |
| Peptide Sequence |
Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444 |
| Description of Target |
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip |
| Protein Interactions |
PLA2G4A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLA2G5 (ARP41429_P050) antibody |
| Blocking Peptide |
For anti-PLA2G5 (ARP41429_P050) antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G5 |
| Uniprot ID |
P39877 |
| Protein Name |
Calcium-dependent phospholipase A2 |
| Publications |
PLA2G5 regulates transglutaminase activity of human IL-4-activated M2 macrophages through PGE2 generation. J. Leukoc. Biol. 100, 131-41 (2016). 26936936 |
| Protein Accession # |
NP_000920 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000929 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLA2G5 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Rat: 86% |
| Image 1 | Human Thymus
 | WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
|
