| Product Number |
ARP41427_P050 |
| Product Page |
www.avivasysbio.com/folr1-antibody-middle-region-arp41427-p050.html |
| Name |
FOLR1 Antibody - middle region (ARP41427_P050) |
| Protein Size (# AA) |
257 amino acids |
| Molecular Weight |
30 kDa |
| NCBI Gene Id |
2348 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Folate receptor 1 (adult) |
| Description |
|
| Alias Symbols |
FBP, FOLR, NCFTD, FRalpha |
| Peptide Sequence |
Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Iwakiri,S., (2008) Ann. Surg. Oncol. 15 (3), 889-899 |
| Description of Target |
The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anc |
| Protein Interactions |
AGO2; NCAPH2; IRAK3; CUL3; PSMB2; IMPDH2; GSR; UBC; Poc1b; Cep76; Trim69; Dync1h1; Cdk1; Cbx1; LYN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-FOLR1 (ARP41427_P050) antibody |
| Blocking Peptide |
For anti-FOLR1 (ARP41427_P050) antibody is Catalog # AAP41427 (Previous Catalog # AAPP24165) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOLR1 |
| Uniprot ID |
P15328 |
| Protein Name |
Folate receptor alpha |
| Publications |
Reinforcing one-carbon metabolism via folic acid/Folr1 promotes β-cell differentiation. Nat Commun. 12, 3362 (2021). 34099692 |
| Sample Type Confirmation |
FOLR1 is supported by BioGPS gene expression data to be expressed in PANC1 |
| Protein Accession # |
NP_000793 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000802 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOLR1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: FOLR1
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: FOLR1
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 5ug/ml |
|
| Image 3 | Human Lung Tissue
 | Rabbit Anti-FOLR1 Antibody
Catalog Number: ARP41427_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
| Image 4 | PANC1 Whole Cell
 | Host: Rabbit
Target Name: FOLR1
Sample Type: PANC1 Whole Cell
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane/Lane
Gel Concentration: 0.12 |
|
| Image 5 | PANC1
 | WB Suggested Anti-FOLR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysateFOLR1 is supported by BioGPS gene expression data to be expressed in PANC1 |
|
| Image 6 | Human Liver
 | Rabbit Anti-FOLR1 Antibody
Catalog Number: ARP41427_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult liver
Observed Staining: Cytoplasmic,Membrane in bile ducts not in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
