Product Number |
ARP41426_P050 |
Product Page |
www.avivasysbio.com/ddc-antibody-middle-region-arp41426-p050.html |
Name |
DDC Antibody - middle region (ARP41426_P050) |
Protein Size (# AA) |
480 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
1644 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dopa decarboxylase (aromatic L-amino acid decarboxylase) |
Alias Symbols |
AADC |
Peptide Sequence |
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315 |
Description of Target |
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. |
Protein Interactions |
ATF6; RELA; AR; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DDC (ARP41426_P050) antibody |
Blocking Peptide |
For anti-DDC (ARP41426_P050) antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DDC |
Uniprot ID |
P20711 |
Protein Name |
Aromatic-L-amino-acid decarboxylase |
Protein Accession # |
NP_000781 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000790 |
Tested Species Reactivity |
Human |
Gene Symbol |
DDC |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Spleen
| WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Spleen |
|
|