FBP1 Antibody - N-terminal region (ARP41406_T100)

Data Sheet
 
Product Number ARP41406_T100
Product Page www.avivasysbio.com/fbp1-antibody-n-terminal-region-arp41406-t100.html
Name FBP1 Antibody - N-terminal region (ARP41406_T100)
Protein Size (# AA) 338 amino acids
Molecular Weight 37kDa
NCBI Gene Id 2203
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Fructose-1,6-bisphosphatase 1
Alias Symbols FBP
Peptide Sequence Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yanez,A.J., (2005) J. Cell. Physiol. 205 (1), 19-24
Description of Target Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Protein Interactions FBP2; FBP1; BIN1; KLRC2; ASL; UBC; POT1; TERF1; PARK2; HDAC6; PTK2; DYNC1I1; CSNK1E; BCL2L1; LNX1; PCNXL4; ATP5J2; ASCC2; RNF183; HSPA8; FXR2; ACTN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FBP1 (ARP41406_T100) antibody
Additional Information IHC Information: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-FBP1 (ARP41406_T100) antibody is Catalog # AAP41406 (Previous Catalog # AAPP24144)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FBP1
Uniprot ID P09467
Protein Name Fructose-1,6-bisphosphatase 1
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Protein Accession # NP_000498
Purification Protein A purified
Nucleotide Accession # NM_000507
Tested Species Reactivity Human
Gene Symbol FBP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Zebrafish: 80%
Image 1
Human Kidney
Rabbit Anti-FBP1 Antibody
Catalog Number: ARP41406
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Lung
Rabbit Anti-FBP1 Antibody
Catalog Number: ARP41406
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphoryation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com