CYP1A1 Antibody - middle region (ARP41404_P050)

• Product Number: ARP41404_P050
• Name: CYP1A1 Antibody - middle region (ARP41404_P050)
• Protein Size (# AA): 512 amino acids
• Molecular Weight: 58 kDa
• NCBI Gene Id: 1543
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome P450, family 1, subfamily A, polypeptide 1
• Alias Symbols: AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX
• Peptide Sequence: Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
• Description of Target: CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: CMTM5; CYB5A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CYP1A1 (ARP41404_P050) antibody is Catalog # AAP41404 (Previous Catalog # AAPP24142)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
• Uniprot ID: P04798
• Protein Name: Cytochrome P450 1A1
• Protein Accession #: NP_000490
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000499
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: CYP1A1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
• Image 1: Human kidney
  
  Sample Type: Human Kidney
  Dilution: 1:100
• Image 2: Mouse Liver
  
  Host: Mouse
  Target Name: CYP1A1
  Sample Tissue: Mouse Liver
  Antibody Dilution: 1ug/ml
• Image 3: Human Liver Tumor
  
  Host: Rabbit
  Target Name: CYP1A1
  Sample Tissue: Human Liver Tumor
  Antibody Dilution: 1ug/ml
• Image 4: Human HCT116 Whole Cell
  
  Host: Rabbit
  Target Name: CYP1A1
  Sample Tissue: Human HCT116 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 5: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: CYP1A1
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 1ug/ml