MAT1A Antibody - C-terminal region (ARP41399_T100)

• Product Number: ARP41399_T100
• Name: MAT1A Antibody - C-terminal region (ARP41399_T100)
• Protein Size (# AA): 395 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 4143
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Methionine adenosyltransferase I, alpha
• Alias Symbols: MAT, SAMS, MATA1, SAMS1
• Peptide Sequence: Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
• Description of Target: MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.
• Protein Interactions: MAT1A; UBC; IST1; MVK; MAT2A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MAT1A (ARP41399_T100) antibody is Catalog # AAP41399 (Previous Catalog # AAPP24137)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAT1A
• Uniprot ID: Q00266
• Protein Name: S-adenosylmethionine synthase isoform type-1
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

• Protein Accession #: NP_000420
• Purification: Protein A purified
• Nucleotide Accession #: NM_000429
• Tested Species Reactivity: Human
• Gene Symbol: MAT1A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
• Image 1: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: MAT1A
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1.0ug/ml