Product Number |
ARP41266_P050 |
Product Page |
www.avivasysbio.com/fzd4-antibody-middle-region-arp41266-p050.html |
Name |
FZD4 Antibody - middle region (ARP41266_P050) |
Protein Size (# AA) |
537 amino acids |
Molecular Weight |
60 kDa |
NCBI Gene Id |
8322 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Frizzled family receptor 4 |
Alias Symbols |
Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S |
Peptide Sequence |
Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dufourcq,P., (2008) Am. J. Pathol. 172 (1), 37-49 |
Description of Target |
FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
UBC; NDP; ZNRF3; BAG6; MAGI3; DLG2; DLG4; DVL2; DLG1; ARRB2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-FZD4 (ARP41266_P050) antibody |
Additional Information |
IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 5 ug/ml. |
Blocking Peptide |
For anti-FZD4 (ARP41266_P050) antibody is Catalog # AAP41266 (Previous Catalog # AAPP22621) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FZD4 |
Uniprot ID |
Q9ULV1 |
Protein Name |
Frizzled-4 |
Publications |
Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). 23251385
McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). 22536405
Wang, L. et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8, e56025 (2013). 23405249 |
Protein Accession # |
NP_036325 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012193 |
Tested Species Reactivity |
Human |
Gene Symbol |
FZD4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human Skin
| Skin |
|
Image 2 | Human Fetal Liver
| Host: Rabbit Target Name: FZD4 Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human lung, 293T
| Host: Rabbit Target: FZD4 Positive control (+): Human lung (LU) Negative control (-): 293T (2T) Antibody concentration: 1ug/ml |
|
Image 4 | Human RPMI 8226 Whole Cell
| Host: Rabbit Target Name: FZD4 Sample Tissue: Human RPMI 8226 Whole Cell Antibody Dilution: 3ug/ml |
|