FZD7 Antibody - C-terminal region (ARP41251_P050)

• Product Number: ARP41251_P050
• Name: FZD7 Antibody - C-terminal region (ARP41251_P050)
• Protein Size (# AA): 574 amino acids
• Molecular Weight: 63kDa
• NCBI Gene Id: 8324
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Frizzled family receptor 7
• Alias Symbols: FzE3
• Peptide Sequence: Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vincan,E., (2005) Differentiation 73 (4), 142-153
• Description of Target: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
• Protein Interactions: UBC; UBQLN4; MAGI3; UBQLN1; DLG2; DLG4; DLG1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FZD7 (ARP41251_P050) antibody is Catalog # AAP41251 (Previous Catalog # AAPP22606)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
• Uniprot ID: O75084
• Protein Name: Frizzled-7
• Publications:

  Gökmen-Polar, Y. et al. Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer. Breast Cancer Res. Treat. 127, 375-84 (2011). 20602165

  McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). 22536405

  Ohba, S., Lanigan, T. M. & Roessler, B. J. Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes. Osteoarthritis Cartilage 18, 1620-9 (2010). 20868760

  Schmuck, R. et al. Genotypic and phenotypic characterization of side population of gastric cancer cell lines. Am. J. Pathol. 178, 1792-804 (2011). 21435459

  Ueno, K. et al. Frizzled-7 as a potential therapeutic target in colorectal cancer. Neoplasia 10, 697-705 (2008). 18592008

• Protein Accession #: NP_003498
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003507
• Tested Species Reactivity: Human
• Gene Symbol: FZD7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Yeast
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
• Image 1: HepG2, Human liver
  
  Host: Rabbit
  Target: FZD7
  Positive control (+): HepG2 (HG)
  Negative control (-): Human liver (LI)
  Antibody concentration: 0.2ug/ml
• Image 2: human kidney
  
  Rabbit Anti-FZD7 Antibody
  Catalog Number: ARP41251
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: FZD7
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1.0ug/ml
• Image 4: Human A549 Whole Cell
  
  Host: Rabbit
  Target Name: FZD7
  Sample Tissue: Human A549 Whole Cell
  Antibody Dilution: 1ug/ml