DND1 Antibody - C-terminal region (ARP41198_P050)

Data Sheet
 
Product Number ARP41198_P050
Product Page www.avivasysbio.com/dnd1-antibody-c-terminal-region-arp41198-p050.html
Name DND1 Antibody - C-terminal region (ARP41198_P050)
Protein Size (# AA) 353 amino acids
Molecular Weight 39kDa
NCBI Gene Id 373863
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dead end homolog 1 (zebrafish)
Alias Symbols RBMS4
Peptide Sequence Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Linger,R., (2008) Genes Chromosomes Cancer 47 (3), 247-252
Description of Target DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DND1 (ARP41198_P050) antibody
Blocking Peptide For anti-DND1 (ARP41198_P050) antibody is Catalog # AAP41198 (Previous Catalog # AAPP22573)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DND1
Uniprot ID Q8IYX4
Protein Name Dead end protein homolog 1
Sample Type Confirmation

DND1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_919225
Purification Affinity Purified
Nucleotide Accession # NM_194249
Tested Species Reactivity Human
Gene Symbol DND1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-DND1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateDND1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Pineal Tissue
Rabbit Anti-DND1 Antibody
Catalog Number: ARP41198_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic in pinealocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com