| Product Number |
ARP41168_P050 |
| Product Page |
www.avivasysbio.com/eif4e3-antibody-middle-region-arp41168-p050.html |
| Name |
EIF4E3 Antibody - middle region (ARP41168_P050) |
| Protein Size (# AA) |
224 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
317649 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Eukaryotic translation initiation factor 4E family member 3 |
| Alias Symbols |
eIF-4E3, eIF4E-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome. |
| Protein Interactions |
ELAVL1; DCC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EIF4E3 (ARP41168_P050) antibody |
| Blocking Peptide |
For anti-EIF4E3 (ARP41168_P050) antibody is Catalog # AAP41168 (Previous Catalog # AAPP22543) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EIF4E3 |
| Uniprot ID |
Q8N5X7 |
| Protein Name |
Eukaryotic translation initiation factor 4E type 3 |
| Publications |
Yi, T., Papadopoulos, E., Hagner, P. R. & Wagner, G. Hypoxia-inducible factor-1a (HIF-1a) promotes cap-dependent translation of selective mRNAs through up-regulating initiation factor eIF4E1 in breast cancer cells under hypoxia conditions. J. Biol. Chem. 288, 18732-42 (2013). 23667251 |
| Protein Accession # |
NP_001128123 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001134649 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EIF4E3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human DLD1
 | Host: Rabbit
Target Name: EIF4E3
Sample Tissue: Human DLD1
Antibody Dilution: 1.0ug/ml |
|
|
