DAZAP1 Antibody - C-terminal region (ARP41161_P050)

• Product Number: ARP41161_P050
• Name: DAZAP1 Antibody - C-terminal region (ARP41161_P050)
• Protein Size (# AA): 378 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 26528
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DAZ associated protein 1
• Alias Symbols: MGC19907
• Peptide Sequence: Synthetic peptide located within the following region: QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pan,H.A., Fertil. Steril. 84 SUPPL 2, 1089-1094 (2005)
• Description of Target: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
• Protein Interactions: UBC; WWOX; RPA3; RPA2; RPA1; SUZ12; RNF2; EZH2; BMI1; rev; ITCH; RAD52; VCAM1; ITGA4; FN1; BRCA1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; ELAVL1; SUMO2; DAZ1; DAZL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DAZAP1 (ARP41161_P050) antibody is Catalog # AAP41161 (Previous Catalog # AAPP22536)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DAZAP1
• Uniprot ID: Q96EP5-2
• Protein Name: DAZ-associated protein 1
• Publications:

  Hayakawa, H. et al. Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress. Biochem. Biophys. Res. Commun. 403, 220-4 (2010). 21073862

• Sample Type Confirmation:

  DAZAP1 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_733829
• Purification: Affinity Purified
• Nucleotide Accession #: NM_170711
• Tested Species Reactivity: Human
• Gene Symbol: DAZAP1
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Kidney
  
  Rabbit Anti-DAZAP1 Antibody
  Catalog Number: ARP41161
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human HepG2
  
  WB Suggested Anti-DAZAP1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysateDAZAP1 is supported by BioGPS gene expression data to be expressed in HepG2