MSI2 Antibody - N-terminal region (ARP41110_P050)

Data Sheet
 
Product Number ARP41110_P050
Product Page www.avivasysbio.com/msi2-antibody-n-terminal-region-arp41110-p050.html
Name MSI2 Antibody - N-terminal region (ARP41110_P050)
Protein Size (# AA) 328 amino acids
Molecular Weight 35kDa
NCBI Gene Id 124540
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Musashi homolog 2 (Drosophila)
Alias Symbols MSI2H
Peptide Sequence Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Barbouti,A., (2003) Cancer Res. 63 (6), 1202-1206
Description of Target MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Interactions MEOX2; HNRNPH2; SUMO2; RPA3; RPA2; RPA1; SUZ12; RNF2; BMI1; TARDBP; SOX2; VCAM1; UBC; CUL3; H2AFX; GRB2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MSI2 (ARP41110_P050) antibody
Blocking Peptide For anti-MSI2 (ARP41110_P050) antibody is Catalog # AAP41110 (Previous Catalog # AAPS02408)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2
Uniprot ID Q96DH6
Protein Name RNA-binding protein Musashi homolog 2
Publications

Cox, J. L. et al. The SOX2-interactome in brain cancer cells identifies the requirement of MSI2 and USP9X for the growth of brain tumor cells. PLoS One 8, e62857 (2013). 23667531

Protein Accession # NP_620412
Purification Affinity Purified
Nucleotide Accession # NM_138962
Tested Species Reactivity Human
Gene Symbol MSI2
Predicted Species Reactivity Human, Mouse, Rat, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HeLa
WB Suggested Anti-MSI2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Image 2
Human K562
MSI2 antibody - N-terminal region (ARP41110_P050) validated by WB using K562 cells lysate at 1:1000.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com