TIA1 Antibody - C-terminal region (ARP40981_P050)

• Product Number: ARP40981_P050
• Name: TIA1 Antibody - C-terminal region (ARP40981_P050)
• Protein Size (# AA): 375 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 7072
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: TIA1 cytotoxic granule-associated RNA binding protein
• Alias Symbols: WDM, ALS26, TIA-1
• Peptide Sequence: Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lopez (2005) Mol. Cell. Biol. 25 (21), 9520-9531
• Description of Target: TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing.The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.
• Protein Interactions: NEDD8; BMI1; SOX2; VCAM1; ITGA4; FN1; FMNL1; WDR6; SRSF3; CAND1; DCUN1D1; COPS5; CUL1; CUL2; CUL3; CUL4A; CUL5; Rc3h1; UBC; RICTOR; FASTK;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TIA1 (ARP40981_P050) antibody is Catalog # AAP40981 (Previous Catalog # AAPP22795)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1
• Uniprot ID: P31483-2
• Protein Name: Nucleolysin TIA-1 isoform p40
• Protein Accession #: NP_071320
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022037
• Tested Species Reactivity: Human
• Gene Symbol: TIA1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 82%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 93%
• Image 1: HEK293 Whole Cell Lysate
  
  TIA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP40981_P050 with 1:200 dilution. Western blot was performed using ARP40981_P050 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: TIA1 IP with ARP40981_P050 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.
• Image 2: Human Thymus
  
  WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Thymus
• Image 3:
  
  50ug HAP1 WT and TIA1 KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/200. (right) Ponceau S staining to verify protein transfer. Data provided courtesy of the YCharOS Antibody Characterization through Open Science group. Additional data can be found at https://ycharos.com/data
• Image 4:
  
  TIA1 was immunoprecipitated from HAP1 WT cell lysates using 1ug of ARP40981_P050 coupled to Dynabeads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated.
• Image 5:
  
  HAP1 WT and TIA1 KO cells were labelled with a green or a far-red fluorescent dye, respectively. WT and KO cells were mixed and plated to a 1:1 ratio in a 96-well plate as a mosaic culture. Cells were stained with ARP40981_P050 at a dilution of 1/500. Bars = 10um.