Product Number |
ARP40851_P050 |
Product Page |
www.avivasysbio.com/oas2-antibody-n-terminal-region-arp40851-p050.html |
Name |
OAS2 Antibody - N-terminal region (ARP40851_P050) |
Protein Size (# AA) |
687 amino acids |
Molecular Weight |
79kDa |
NCBI Gene Id |
4939 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
2'-5'-oligoadenylate synthetase 2, 69/71kDa |
Alias Symbols |
MGC78578 |
Peptide Sequence |
Synthetic peptide located within the following region: DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer,S.E., (2006) Nature 440 (7082), 346-351 |
Description of Target |
OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein Interactions |
UBC; CLK3; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-OAS2 (ARP40851_P050) antibody |
Blocking Peptide |
For anti-OAS2 (ARP40851_P050) antibody is Catalog # AAP40851 (Previous Catalog # AAPP22834) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human OAS2 |
Uniprot ID |
P29728-2 |
Protein Name |
2'-5'-oligoadenylate synthase 2 |
Protein Accession # |
NP_002526 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002535 |
Tested Species Reactivity |
Human |
Gene Symbol |
OAS2 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Placenta, Human Brain
| Host: Rabbit Target: OAS2 Positive control (+): Human Placenta (PL) Negative control (-): Human Brain (BR) Antibody concentration: 0.5ug/ml |
|
Image 2 | Human SH-SYSY
| WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: SH-SYSY cell lysate |
|