OAS2 Antibody - N-terminal region (ARP40851_P050)
Data Sheet
 
Product Number ARP40851_P050
Product Page www.avivasysbio.com/oas2-antibody-n-terminal-region-arp40851-p050.html
Product Name OAS2 Antibody - N-terminal region (ARP40851_P050)
Size 100 ul
Gene Symbol OAS2
Alias Symbols MGC78578
Protein Size (# AA) 687 amino acids
Molecular Weight 79kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4939
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name 2'-5'-oligoadenylate synthetase 2, 69/71kDa
Peptide Sequence Synthetic peptide located within the following region: DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL
Target Reference Scherer,S.E., (2006) Nature 440 (7082), 346-351
Description of Target OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Interactions UBC; CLK3; APP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-OAS2 (ARP40851_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-OAS2 (ARP40851_P050) antibody is Catalog # AAP40851 (Previous Catalog # AAPP22834)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OAS2
Complete computational species homology data Anti-OAS2 (ARP40851_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OAS2.
Swissprot Id P29728-2
Protein Name 2'-5'-oligoadenylate synthase 2
Protein Accession # NP_002526
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OAS2.
Nucleotide Accession # NM_002535
Replacement Item This antibody may replace item sc-271117 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human SH-SYSY
WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SH-SYSY cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com