OAS2 Antibody - N-terminal region (ARP40851_P050)

• Product Number: ARP40851_P050
• Name: OAS2 Antibody - N-terminal region (ARP40851_P050)
• Protein Size (# AA): 687 amino acids
• Molecular Weight: 79kDa
• NCBI Gene Id: 4939
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 2'-5'-oligoadenylate synthetase 2, 69/71kDa
• Alias Symbols: MGC78578
• Peptide Sequence: Synthetic peptide located within the following region: DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Scherer,S.E., (2006) Nature 440 (7082), 346-351
• Description of Target: OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.
• Protein Interactions: UBC; CLK3; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OAS2 (ARP40851_P050) antibody is Catalog # AAP40851 (Previous Catalog # AAPP22834)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OAS2
• Uniprot ID: P29728-2
• Protein Name: 2'-5'-oligoadenylate synthase 2
• Protein Accession #: NP_002526
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002535
• Tested Species Reactivity: Human
• Gene Symbol: OAS2
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Image 1: Human Placenta, Human Brain
  
  Host: Rabbit
  Target: OAS2
  Positive control (+): Human Placenta (PL)
  Negative control (-): Human Brain (BR)
  Antibody concentration: 0.5ug/ml
• Image 2: Human SH-SYSY
  
  WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: SH-SYSY cell lysate