LARP7 Antibody - C-terminal region (ARP40847_P050)

Data Sheet
 
Product Number ARP40847_P050
Product Page www.avivasysbio.com/larp7-antibody-c-terminal-region-arp40847-p050.html
Name LARP7 Antibody - C-terminal region (ARP40847_P050)
Protein Size (# AA) 582 amino acids
Molecular Weight 67kDa
NCBI Gene Id 51574
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name La ribonucleoprotein domain family, member 7
Description
Alias Symbols ALAZS, PIP7S, hLARP7, HDCMA18P
Peptide Sequence Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Krueger,B.J., (2008) Nucleic Acids Res. 36 (7), 2219-2229
Description of Target The function remains unknown.
Protein Interactions HEXIM1; AFF1; CDK9; CCNT1; UBC; LIN28B; LIN28A; MEPCE; RNF2; VCPIP1; RABEP2; BRCC3; RPP25; CD2AP; JMJD6; HNRNPR; TRIM28; HUWE1; MTA2; SPAG9; TSC22D1; HDAC1; NR3C1; RN7SK; RPS16; HNRNPA1; CSNK2A1; tat; PAXIP1; BARD1; APP; CAND1; SIRT7; PRPF40A; Ybx1; Nhp2l
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LARP7 (ARP40847_P050) antibody
Blocking Peptide For anti-LARP7 (ARP40847_P050) antibody is Catalog # AAP40847 (Previous Catalog # AAPY01099)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7
Uniprot ID Q4G0J3
Protein Name La-related protein 7
Publications

Muniz, L., Egloff, S. & Kiss, T. RNA elements directing in vivo assembly of the 7SK/MePCE/Larp7 transcriptional regulatory snRNP. Nucleic Acids Res. 41, 4686-98 (2013). 23471002

The 7SK snRNP associates with the little elongation complex to promote snRNA gene expression. EMBO J. 36, 934-948 (2017). 28254838

The HIV-1 Tat protein recruits a ubiquitin ligase to reorganize the 7SK snRNP for transcriptional activation. Elife. 7, (2018). 29845934

Protein Accession # NP_056269
Purification Affinity Purified
Nucleotide Accession # NM_015454
Tested Species Reactivity Human
Gene Symbol LARP7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Hela
Host: Rabbit
Target Name: LARP7
Sample Tissue: Human Hela
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com