SLBP Antibody - middle region (ARP40657_P050)

• Product Number: ARP40657_P050
• Name: SLBP Antibody - middle region (ARP40657_P050)
• Protein Size (# AA): 270 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 7884
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Stem-loop binding protein
• Alias Symbols: HBP
• Peptide Sequence: Synthetic peptide located within the following region: INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Borchers,C.H., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (9), 3094-3099
• Description of Target: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.
• Protein Interactions: UBC; CDK6; CDK4; UPF1; LSM10; ZNF473; USP8; ERI1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLBP (ARP40657_P050) antibody is Catalog # AAP40657 (Previous Catalog # AAPP10405)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLBP
• Uniprot ID: Q14493
• Protein Name: Histone RNA hairpin-binding protein
• Sample Type Confirmation:

  SLBP is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_006518
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006527
• Tested Species Reactivity: Human
• Gene Symbol: SLBP
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Bronchial Epithelial Tissue
  
  Rabbit Anti-SLBP Antibody
  Catalog Number: ARP40657_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2: Human HepG2
  
  WB Suggested Anti-SLBP Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysateSLBP is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: THP1 Cell Lysate, A549 Cell Lysate
  
  Host: Rabbit
  Target: SLBP
  Positive control (+): THP1 Cell Lysate (N30)
  Negative control (-): A549 Cell Lysate (N03)
  Antibody concentration: 3ug/ml