HNRPM Antibody - N-terminal region (ARP40620_P050)

Data Sheet
 
Product Number ARP40620_P050
Product Page www.avivasysbio.com/hnrpm-antibody-n-terminal-region-arp40620-p050.html
Name HNRPM Antibody - N-terminal region (ARP40620_P050)
Protein Size (# AA) 691 amino acids
Molecular Weight 73kDa
NCBI Gene Id 4670
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Heterogeneous nuclear ribonucleoprotein M
Alias Symbols CEAR, HNRPM, HTGR1, NAGR1, HNRPM4, HNRNPM4, hnRNP M
Peptide Sequence Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPM has three repeats of quasi-RRM domains that bind to RNAs. HNRPM also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated.
Protein Interactions UBC; TP53; AKAP9; TEKT4; GMCL1P1; LMO2; HNRNPF; SUMO2; SUMO3; CEP250; MDM2; HAUS1; CDC37; IVNS1ABP; STAU1; SUMO1; RPA3; RPA2; RPA1; EED; rev; RTCB; RPL26L1; RFC4; PSMB8; NMT1; MRE11A; FLII; IGF2BP3; EIF2B2; EIF2B3; RPL27; RPL19; DHX9; DDX1; ABCF1; PARK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HNRNPM (ARP40620_P050) antibody
Blocking Peptide For anti-HNRNPM (ARP40620_P050) antibody is Catalog # AAP40620 (Previous Catalog # AAPP22380)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPM
Uniprot ID P52272
Protein Name Heterogeneous nuclear ribonucleoprotein M
Publications

Huelga, S. C. et al. Integrative genome-wide analysis reveals cooperative regulation of alternative splicing by hnRNP proteins. Cell Rep. 1, 167-78 (2012). 22574288

Sample Type Confirmation

HNRNPM is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_112480
Purification Affinity Purified
Nucleotide Accession # NM_031203
Tested Species Reactivity Human
Gene Symbol HNRNPM
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateHNRNPM is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com