KARS Antibody - C-terminal region (ARP40589_P050)

Data Sheet
 
Product Number ARP40589_P050
Product Page www.avivasysbio.com/kars-antibody-c-terminal-region-arp40589-p050.html
Name KARS Antibody - C-terminal region (ARP40589_P050)
Protein Size (# AA) 597 amino acids
Molecular Weight 66kDa
NCBI Gene Id 3735
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysyl-tRNA synthetase
Alias Symbols KRS, KARS, KARS2, LEPID, CMTRIB, DEAPLE, DFNB89
Peptide Sequence Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Halwani,R., (2004) J. Virol. 78 (14), 7553-7564
Description of Target Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.
Protein Interactions AIMP2; SUMO2; SUMO3; MDM2; UBC; SUMO1; NEDD8; STAT1; SSB; RPL21; RPL19; RPL17; NAP1L4; HSPA4; GPX1; CARS; APEH; CAND1; RANBP6; RPL36; JMJD6; NUDC; IPO7; AIMP1; SH3RF2; FBXO6; vpr; MSK1; gag; FN1; TRMT1; MRPS18B; UBE2S; CCT8; EEF1E1; VBP1; UBA1; RARS; QARS
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KARS (ARP40589_P050) antibody
Blocking Peptide For anti-KARS (ARP40589_P050) antibody is Catalog # AAP40589 (Previous Catalog # AAPP22349)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KARS
Uniprot ID Q15046
Protein Name Lysine--tRNA ligase
Sample Type Confirmation

KARS is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_005539
Purification Affinity Purified
Nucleotide Accession # NM_005548
Tested Species Reactivity Human
Gene Symbol KARS
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 85%; Horse: 88%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-KARS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateKARS is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Image 2
Human Intestine
Rabbit Anti-KARS Antibody
Catalog Number: ARP40589
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Bronchial Epithelial Tissue
KARS antibody - C-terminal region (ARP40589_P050)
Catalog Number: ARP40589_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasm of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com