EIF2S2 Antibody - N-terminal region (ARP40501_P050)
Data Sheet
 
Product Number ARP40501_P050
Product Page www.avivasysbio.com/eif2s2-antibody-n-terminal-region-arp40501-p050.html
Product Name EIF2S2 Antibody - N-terminal region (ARP40501_P050)
Size 100 ul
Gene Symbol EIF2S2
Alias Symbols DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC8508, PPP1R67
Protein Size (# AA) 333 amino acids
Molecular Weight 38kDa
Subunit 2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 8894
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Peptide Sequence Synthetic peptide located within the following region: DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD
Target Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; SUMO2; SUMO3; RPA3; RPA2; RPA1; RNF2; SUZ12; rev; GCN1L1; EIF2S1; HMGA1; MMS19; UPF1; CSNK2B; CSNK2A1; PAXIP1; APP; CAND1; HDGF; DCC; H2AFX; KIAA1377; CCDC90B; ZBTB16; PLEKHM1; EIF2B4; EIF2B1; EIF2B3; EIF4G2; UNC119; EIF2B5; CRMP1; EIF5; PRKDC; NCK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-EIF2S2 (ARP40501_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-EIF2S2 (ARP40501_P050) antibody is Catalog # AAP40501 (Previous Catalog # AAPP22708)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S2
Complete computational species homology data Anti-EIF2S2 (ARP40501_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EIF2S2.
Swissprot Id P20042
Protein Name Eukaryotic translation initiation factor 2 subunit 2
Protein Accession # NP_003899
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EIF2S2.
Nucleotide Accession # NM_003908
Replacement Item This antibody may replace item sc-110792 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-EIF2S2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com