SRGN Antibody - middle region (ARP40416_P050)

• Product Number: ARP40416_P050
• Name: SRGN Antibody - middle region (ARP40416_P050)
• Protein Size (# AA): 158 amino acids
• Molecular Weight: 18kDa
• NCBI Gene Id: 5552
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Serglycin
• Alias Symbols: PPG, PRG, PRG1
• Peptide Sequence: Synthetic peptide located within the following region: RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ma,D., (2008) Pediatr Blood Cancer 50 (5), 1067-1069
• Description of Target: SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBQLN1; SGTA; UBQLN4; PSRC1; CEP70; UBR4; BAG6; CCL3; PF4; GZMB; CD44; ALB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SRGN (ARP40416_P050) antibody is Catalog # AAP40416 (Previous Catalog # AAPS02912)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRGN
• Uniprot ID: P10124
• Protein Name: Serglycin
• Protein Accession #: NP_002718
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002727
• Tested Species Reactivity: Human
• Gene Symbol: SRGN
• Predicted Species Reactivity: Human, Rat, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 78%; Horse: 100%; Human: 100%; Pig: 91%; Rabbit: 86%; Rat: 93%
• Image 1: Human U937 Whole Cell
  
  Host: Rabbit
  Target Name: SRGN
  Sample Tissue: Human U937 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Transfected 293T
  
  WB Suggested Anti-SRGN Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Transfected 293T