| Product Number |
ARP40383_T100 |
| Product Page |
www.avivasysbio.com/hnrpa1-antibody-n-terminal-region-arp40383-t100.html |
| Name |
HNRPA1 Antibody - N-terminal region (ARP40383_T100) |
| Protein Size (# AA) |
320 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
3178 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Heterogeneous nuclear ribonucleoprotein A1 |
| Description |
|
| Alias Symbols |
UP 1, ALS19, ALS20, HNRPA1, IBMPFD3, HNRPA1L3, hnRNP A1, hnRNP-A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tevosian,S.G., (2005) J. Biol. Chem. 280 (13), 13171-13178 |
| Description of Target |
HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites. |
| Protein Interactions |
UBC; TP53; PSMD9; TUBGCP3; NEDD1; AURKB; AURKA; STAU1; IVNS1ABP; TNF; PSMB4; MDM2; CHUK; RPA3; RPA2; RPA1; ASB2; ERG; EED; RNF2; rev; IQGAP1; HIST1H2AB; AIMP2; RPL38; RPL27A; QARS; DHX9; CCAR2; ZC3HC1; HNRNPU; PARK2; FBXO6; TARDBP; YWHAQ; SRPK1; XRN1; CSF |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HNRNPA1 (ARP40383_T100) antibody |
| Blocking Peptide |
For anti-HNRNPA1 (ARP40383_T100) antibody is Catalog # AAP40383 (Previous Catalog # AAPP22127) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA1 |
| Uniprot ID |
Q6IPF2 |
| Protein Name |
Heterogeneous nuclear ribonucleoprotein A1 EMBL AAH71945.1 |
| Publications |
Gonen, N. & Assaraf, Y. G. The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1. J. Biol. Chem. 285, 33602-13 (2010). 20724482
Li, S. et al. Aptamer BC15 against heterogeneous nuclear ribonucleoprotein A1 has potential value in diagnosis and therapy of hepatocarcinoma. Nucleic Acid Ther. 22, 391-8 (2012). 23062008
Li, S. et al. Identification of an aptamer targeting hnRNP A1 by tissue slide-based SELEX. J. Pathol. 218, 327-36 (2009). 19291713
Regulation of SR protein phosphorylation and alternative splicing by modulating kinetic interactions of SRPK1 with molecular chaperones. Genes Dev. 23, 482-95 (2009). 19240134
Stark, M., Bram, E. E., Akerman, M., Mandel-Gutfreund, Y. & Assaraf, Y. G. Heterogeneous nuclear ribonucleoprotein H1/H2-dependent unsplicing of thymidine phosphorylase results in anticancer drug resistance. J. Biol. Chem. 286, 3741-54 (2011). 21068389 |
| Sample Type Confirmation |
HNRNPA1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_002127 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002136 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HNRNPA1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Heart
 | Rabbit Anti-HNRPA1 antibody
Catalog Number: ARP40383
Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Liver
 | Rabbit Anti-HNRPA1 Antibody
Catalog Number: ARP40383
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 3 | Human Heart
 | Rabbit Anti-HNRPA1 Antibody
Catalog Number: ARP40383
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 | Human Jurkat
 | WB Suggested Anti-HNRPA1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateHNRNPA1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
