FBL Antibody - N-terminal region (ARP40366_T100)

• Product Number: ARP40366_T100
• Name: FBL Antibody - N-terminal region (ARP40366_T100)
• Protein Size (# AA): 321 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 2091
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Fibrillarin
• Alias Symbols: FIB, FLRN, Nop1, RNU3IP1
• Peptide Sequence: Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bouwmeester,T., (2004) Nat. Cell Biol. 6 (2), 97-105
• Description of Target: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
• Protein Interactions: UBC; CEP250; TP53; SUMO2; SUMO3; LIN28A; LIN28B; RPA3; RPA2; RPA1; ERG; RNF2; BMI1; SUZ12; EED; EZH2; TARDBP; UBD; NCL; ARFGEF1; PAN2; CBX8; ITGA4; FN1; VCAM1; MAGOH; EIF4A3; EEF1A1; DHX15; NSUN2; NOP58; MRTO4; GNL3; RSL1D1; SRRM2; BOP1; RRS1; EBNA1BP2; P
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBL (ARP40366_T100) antibody is Catalog # AAP40366 (Previous Catalog # AAPP22110)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBL
• Uniprot ID: P22087
• Protein Name: rRNA 2'-O-methyltransferase fibrillarin
• Publications:

  Armistead, J. et al. Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome. Am. J. Hum. Genet. 84, 728-39 (2009). 19463982

  Ernoult-Lange, M. et al. Nucleocytoplasmic traffic of CPEB1 and accumulation in Crm1 nucleolar bodies. Mol. Biol. Cell 20, 176-87 (2009). 18923137

• Sample Type Confirmation:

  FBL is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_001427
• Purification: Protein A purified
• Nucleotide Accession #: NM_001436
• Tested Species Reactivity: Human
• Gene Symbol: FBL
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-FBL Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:12500
  Positive Control: Jurkat cell lysateFBL is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 2: Human Intestine
  
  Rabbit Anti-FBL Antibody
  Catalog Number: ARP40366
  Paraffin Embedded Tissue: Human Intestine
  Cellular Data: Epithelial cells of intestinal villas
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X