Mbd3 Antibody - N-terminal region (ARP40171_P050)

Data Sheet
 
Product Number ARP40171_P050
Product Page www.avivasysbio.com/mbd3-antibody-n-terminal-region-arp40171-p050.html
Name Mbd3 Antibody - N-terminal region (ARP40171_P050)
Protein Size (# AA) 285 amino acids
Molecular Weight 32kDa
NCBI Gene Id 17192
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Methyl-CpG binding domain protein 3
Alias Symbols AI181826, AU019209
Peptide Sequence Synthetic peptide located within the following region: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of Mbd3 remains unknown.
Protein Interactions Nanog; Plcb1; L3mbtl2; Pou5f1; Runx1; Mta2; Gata1; SMARCA4; DNMT3A; Mta1; Sall4; Tfcp2l1; Esrrb; Hdac2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Mbd3 (ARP40171_P050) antibody
Blocking Peptide For anti-Mbd3 (ARP40171_P050) antibody is Catalog # AAP40171 (Previous Catalog # AAPP20914)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q9Z2D8
Protein Name Methyl-CpG-binding domain protein 3
Protein Accession # NP_038623
Purification Affinity Purified
Nucleotide Accession # NM_013595
Tested Species Reactivity Mouse
Gene Symbol Mbd3
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Mouse Heart
WB Suggested Anti-Mbd3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com