Product Number |
ARP40171_P050 |
Product Page |
www.avivasysbio.com/mbd3-antibody-n-terminal-region-arp40171-p050.html |
Name |
Mbd3 Antibody - N-terminal region (ARP40171_P050) |
Protein Size (# AA) |
285 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
17192 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Methyl-CpG binding domain protein 3 |
Alias Symbols |
AI181826, AU019209 |
Peptide Sequence |
Synthetic peptide located within the following region: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Mbd3 remains unknown. |
Protein Interactions |
Nanog; Plcb1; L3mbtl2; Pou5f1; Runx1; Mta2; Gata1; SMARCA4; DNMT3A; Mta1; Sall4; Tfcp2l1; Esrrb; Hdac2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Mbd3 (ARP40171_P050) antibody |
Blocking Peptide |
For anti-Mbd3 (ARP40171_P050) antibody is Catalog # AAP40171 (Previous Catalog # AAPP20914) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q9Z2D8 |
Protein Name |
Methyl-CpG-binding domain protein 3 |
Protein Accession # |
NP_038623 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013595 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Mbd3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Mouse Heart
| WB Suggested Anti-Mbd3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Mouse Heart |
|
|