Product Number |
ARP40136_P050-HRP |
Product Page |
www.avivasysbio.com/ehf-antibody-n-terminal-region-hrp-arp40136-p050-hrp.html |
Name |
Ehf Antibody - N-terminal region : HRP (ARP40136_P050-HRP) |
Protein Size (# AA) |
300 amino acids |
Molecular Weight |
33kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
13661 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ets homologous factor |
Alias Symbols |
AU019492, 9030625L19Rik |
Peptide Sequence |
Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
Ko,M.S., (2000) Development 127 (8), 1737-1749 |
Description of Target |
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter |
Protein Interactions |
Nfkbiz; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-Ehf (ARP40136_P050-HRP) antibody |
Blocking Peptide |
For anti-Ehf (ARP40136_P050-HRP) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf |
Uniprot ID |
Q9NZC4 |
Protein Name |
ETS homologous factor |
Publications |
He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). WB, Mouse, Rat, Human, Pig, Horse, Rabbit, Guinea pig, Sheep, Dog, Bovine 17172821 |
Protein Accession # |
NP_031940 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007914 |
Gene Symbol |
Ehf |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93% |
Image 1 | |
|