Ehf Antibody - N-terminal region : Biotin (ARP40136_P050-Biotin)

Data Sheet
 
Product Number ARP40136_P050-Biotin
Product Page www.avivasysbio.com/ehf-antibody-n-terminal-region-biotin-arp40136-p050-biotin.html
Name Ehf Antibody - N-terminal region : Biotin (ARP40136_P050-Biotin)
Protein Size (# AA) 300 amino acids
Molecular Weight 33kDa
Conjugation Biotin
NCBI Gene Id 13661
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ets homologous factor
Alias Symbols AU019492, 9030625L19Rik
Peptide Sequence Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Ko,M.S., (2000) Development 127 (8), 1737-1749
Description of Target Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Protein Interactions Nfkbiz;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-Ehf (ARP40136_P050-Biotin) antibody
Blocking Peptide For anti-Ehf (ARP40136_P050-Biotin) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
Uniprot ID Q9NZC4
Protein Name ETS homologous factor
Publications

He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). WB, Mouse, Rat, Human, Pig, Horse, Rabbit, Guinea pig, Sheep, Dog, Bovine 17172821

Protein Accession # NP_031940
Purification Affinity Purified
Nucleotide Accession # NM_007914
Gene Symbol Ehf
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com