NOBOX Antibody - N-terminal region : FITC (ARP40110_P050-FITC)

• Product Number: ARP40110_P050-FITC
• Name: NOBOX Antibody - N-terminal region : FITC (ARP40110_P050-FITC)
• Protein Size (# AA): 490 amino acids
• Molecular Weight: 54kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 135935
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: NOBOX oogenesis homeobox
• Alias Symbols: OG2, OG-2, OG2X, POF5, TCAG_12042
• Peptide Sequence: Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Huntriss J, (2006) Mol Hum Reprod. 2006 May;12(5):283-9.
• Description of Target: NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-NOBOX (ARP40110_P050-FITC) antibody is Catalog # AAP40110 (Previous Catalog # AAPP22944)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX
• Protein Accession #: XP_001134424
• Purification: Affinity Purified
• Nucleotide Accession #: XM_001134424
• Gene Symbol: NOBOX
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: