| Product Number |
ARP39932_P050 |
| Product Page |
www.avivasysbio.com/hoxa9-antibody-middle-region-arp39932-p050.html |
| Name |
HOXA9 Antibody - middle region (ARP39932_P050) |
| Protein Size (# AA) |
272 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
3205 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox A9 |
| Alias Symbols |
HOX1, ABD-B, HOX1G, HOX1.7 |
| Peptide Sequence |
Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169 |
| Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXA9 (ARP39932_P050) antibody |
| Blocking Peptide |
For anti-HOXA9 (ARP39932_P050) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9 |
| Uniprot ID |
P31269 |
| Protein Name |
Homeobox protein Hox-A9 |
| Publications |
Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). 23624935 |
| Protein Accession # |
NP_689952 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152739 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXA9 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93% |
| Image 1 | Human 721_B
 | WB Suggested Anti-HOXA9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate |
|
