GLIS3 Antibody - C-terminal region (ARP39925_P050)

Data Sheet
 
Product Number ARP39925_P050
Product Page www.avivasysbio.com/glis3-antibody-c-terminal-region-arp39925-p050.html
Name GLIS3 Antibody - C-terminal region (ARP39925_P050)
Protein Size (# AA) 775 amino acids
Molecular Weight 84kDa
NCBI Gene Id 169792
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GLIS family zinc finger 3
Alias Symbols NDH, ZNF515
Peptide Sequence Synthetic peptide located within the following region: QASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target GLIS3 is a member of the GLI-similar zinc finger protein family and has five C2H2-type zinc finger domains. GLIS3 functions as both a repressor and activator of transcription and is specifically involved in the development of pancreatic beta cells, the thyroid, eye, liver and kidney. Mutations in this gene have been associated with neonatal diabetes and congenital hypothyroidism (NDH).
Protein Interactions SUFU; SOX2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GLIS3 (ARP39925_P050) antibody
Blocking Peptide For anti-GLIS3 (ARP39925_P050) antibody is Catalog # AAP39925 (Previous Catalog # AAPP10239)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GLIS3
Uniprot ID Q8NEA6
Protein Name Zinc finger protein GLIS3
Protein Accession # ABE66435
Purification Affinity Purified
Nucleotide Accession # NM_001042413
Tested Species Reactivity Human
Gene Symbol GLIS3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-GLIS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human 293T Whole Cell
Host: Rabbit
Target Name: GLIS3
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com