Product Number |
ARP39925_P050 |
Product Page |
www.avivasysbio.com/glis3-antibody-c-terminal-region-arp39925-p050.html |
Name |
GLIS3 Antibody - C-terminal region (ARP39925_P050) |
Protein Size (# AA) |
775 amino acids |
Molecular Weight |
84kDa |
NCBI Gene Id |
169792 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
GLIS family zinc finger 3 |
Alias Symbols |
NDH, ZNF515 |
Peptide Sequence |
Synthetic peptide located within the following region: QASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
GLIS3 is a member of the GLI-similar zinc finger protein family and has five C2H2-type zinc finger domains. GLIS3 functions as both a repressor and activator of transcription and is specifically involved in the development of pancreatic beta cells, the thyroid, eye, liver and kidney. Mutations in this gene have been associated with neonatal diabetes and congenital hypothyroidism (NDH). |
Protein Interactions |
SUFU; SOX2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GLIS3 (ARP39925_P050) antibody |
Blocking Peptide |
For anti-GLIS3 (ARP39925_P050) antibody is Catalog # AAP39925 (Previous Catalog # AAPP10239) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GLIS3 |
Uniprot ID |
Q8NEA6 |
Protein Name |
Zinc finger protein GLIS3 |
Protein Accession # |
ABE66435 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001042413 |
Tested Species Reactivity |
Human |
Gene Symbol |
GLIS3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-GLIS3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
| Image 2 | Human 293T Whole Cell
| Host: Rabbit Target Name: GLIS3 Sample Tissue: Human 293T Whole Cell Antibody Dilution: 1ug/ml |
|
|