PML Antibody - middle region (ARP39753_P050)

Data Sheet
 
Product Number ARP39753_P050
Product Page www.avivasysbio.com/pml-antibody-middle-region-arp39753-p050.html
Name PML Antibody - middle region (ARP39753_P050)
Protein Size (# AA) 882 amino acids
Molecular Weight 97kDa
NCBI Gene Id 5371
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Promyelocytic leukemia
Alias Symbols MYL, RNF71, PP8675, TRIM19
Peptide Sequence Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Eun,B., (2008) J. Biol. Chem. 283 (9), 5939-5949
Description of Target PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor an
Protein Interactions RPL11; RPL5; SUMO1; UBC; TP53; SUMO2; SUMO3; MDM2; RNF4; EGFR; NCOA2; SP100; DAXX; MAPK7; HDAC1; ATXN1; ATRX; ASF1A; EHMT2; HIRA; HTT; H3F3A; ATF7IP; PML; JAK1; EIF4E; GLIS2; UBE2I; smt3; HDAC11; HDAC6; LMNA; RNF111; CDK6; CDK2; CDK1; CASP8AP2; RBX1; SH3G
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PML (ARP39753_P050) antibody
Specificity isoform 1, 9, 10 and 11 specific
Blocking Peptide For anti-PML (ARP39753_P050) antibody is Catalog # AAP39753 (Previous Catalog # AAPP21778)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PML
Uniprot ID P29590
Protein Name Protein PML
Sample Type Confirmation

There is BioGPS gene expression data showing that PML is expressed in ACHN

Protein Accession # NP_150241
Purification Affinity Purified
Nucleotide Accession # NM_033238
Tested Species Reactivity Human
Gene Symbol PML
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Transfected IMR32
PML antibody - middle region (ARP39753_P050) validated by WB using Neuroblastoma at 1:500.
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: SERPINA3
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com