CBLL1 Antibody - N-terminal region : HRP (ARP39622_P050-HRP)

Data Sheet
 
Product Number ARP39622_P050-HRP
Product Page www.avivasysbio.com/cbll1-antibody-n-terminal-region-hrp-arp39622-p050-hrp.html
Name CBLL1 Antibody - N-terminal region : HRP (ARP39622_P050-HRP)
Protein Size (# AA) 491 amino acids
Molecular Weight 54kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 79872
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1
Alias Symbols HAKAI, RNF188
Peptide Sequence Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Ota,T., J. Cell. Sci. 117 (PT 7), 989-998 (2004)
Description of Target Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a conse
Protein Interactions DGCR6; SUMO1; UBC; CDH1; RNF2; YWHAQ; SFPQ; Cbll1; ESR1; CTTN; DOK1; SRC; CDC42;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CBLL1 (ARP39622_P050-HRP) antibody
Blocking Peptide For anti-CBLL1 (ARP39622_P050-HRP) antibody is Catalog # AAP39622 (Previous Catalog # AAPP21642)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CBLL1
Uniprot ID Q75N03
Protein Name E3 ubiquitin-protein ligase Hakai
Protein Accession # NP_079090
Purification Affinity Purified
Nucleotide Accession # NM_024814
Gene Symbol CBLL1
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com