ZNF419 Antibody - N-terminal region (ARP39606_P050)

Data Sheet
 
Product Number ARP39606_P050
Product Page www.avivasysbio.com/znf419-antibody-n-terminal-region-arp39606-p050.html
Name ZNF419 Antibody - N-terminal region (ARP39606_P050)
Protein Size (# AA) 510 amino acids
Molecular Weight 58kDa
NCBI Gene Id 79744
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 419
Alias Symbols ZAPHIR, ZNF419A
Peptide Sequence Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718
Description of Target ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation.
Protein Interactions KRTAP10-7; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF419 (ARP39606_P050) antibody
Blocking Peptide For anti-ZNF419 (ARP39606_P050) antibody is Catalog # AAP39606 (Previous Catalog # AAPP23092)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF419
Uniprot ID Q96HQ0
Protein Name Zinc finger protein 419
Sample Type Confirmation

ZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_078967
Purification Affinity Purified
Nucleotide Accession # NM_024691
Tested Species Reactivity Human
Gene Symbol ZNF419
Predicted Species Reactivity Human, Cow, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Horse: 83%; Human: 100%
Image 1
Human 293T
WB Suggested Anti-ZNF419 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T
Image 2
Human Adult Liver
Rabbit Anti-ZNF419 Antibody
Catalog Number: ARP39606_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com