Product Number |
ARP39606_P050 |
Product Page |
www.avivasysbio.com/znf419-antibody-n-terminal-region-arp39606-p050.html |
Name |
ZNF419 Antibody - N-terminal region (ARP39606_P050) |
Protein Size (# AA) |
510 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
79744 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 419 |
Alias Symbols |
ZAPHIR, ZNF419A |
Peptide Sequence |
Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718 |
Description of Target |
ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation. |
Protein Interactions |
KRTAP10-7; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF419 (ARP39606_P050) antibody |
Blocking Peptide |
For anti-ZNF419 (ARP39606_P050) antibody is Catalog # AAP39606 (Previous Catalog # AAPP23092) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF419 |
Uniprot ID |
Q96HQ0 |
Protein Name |
Zinc finger protein 419 |
Sample Type Confirmation |
ZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_078967 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024691 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF419 |
Predicted Species Reactivity |
Human, Cow, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Horse: 83%; Human: 100% |
Image 1 | Human 293T
| WB Suggested Anti-ZNF419 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysateZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Image 2 | Human Adult Liver
| Rabbit Anti-ZNF419 Antibody
Catalog Number: ARP39606_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
|