| Product Number |
ARP39552_P050-FITC |
| Product Page |
www.avivasysbio.com/sox17-antibody-middle-region-fitc-arp39552-p050-fitc.html |
| Name |
SOX17 Antibody - middle region : FITC (ARP39552_P050-FITC) |
| Protein Size (# AA) |
414 amino acids |
| Molecular Weight |
44kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
64321 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 17 |
| Alias Symbols |
VUR3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Zhang,W., (2008) Cancer Res. 68 (8), 2764-2772 |
| Description of Target |
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
| Protein Interactions |
CTNNB1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX17 (ARP39552_P050-FITC) antibody |
| Blocking Peptide |
For anti-SOX17 (ARP39552_P050-FITC) antibody is Catalog # AAP39552 (Previous Catalog # AAPP23082) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SOX17 |
| Uniprot ID |
Q9H6I2 |
| Protein Name |
Transcription factor SOX-17 |
| Publications |
Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). WB, Human, Pig, Guinea pig, Dog, Rat, Mouse 24707296 |
| Protein Accession # |
NP_071899 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022454 |
| Gene Symbol |
SOX17 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86% |
| Image 1 | |
|
