SOX17 Antibody - middle region (ARP39552_P050)

Data Sheet
 
Product Number ARP39552_P050
Product Page www.avivasysbio.com/sox17-antibody-middle-region-arp39552-p050.html
Name SOX17 Antibody - middle region (ARP39552_P050)
Protein Size (# AA) 414 amino acids
Molecular Weight 44kDa
NCBI Gene Id 64321
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SRY (sex determining region Y)-box 17
Description
Alias Symbols VUR3
Peptide Sequence Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,W., (2008) Cancer Res. 68 (8), 2764-2772
Description of Target The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Protein Interactions CTNNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX17 (ARP39552_P050) antibody
Blocking Peptide For anti-SOX17 (ARP39552_P050) antibody is Catalog # AAP39552 (Previous Catalog # AAPP23082)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SOX17
Uniprot ID Q9H6I2
Protein Name Transcription factor SOX-17
Publications

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296

Protein Accession # NP_071899
Purification Affinity Purified
Nucleotide Accession # NM_022454
Tested Species Reactivity Human
Gene Symbol SOX17
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig
Application WB, IHC, FC
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86%
Image 1
Human Kidney
Rabbit Anti-SOX17 Antibody
Catalog Number: ARP39552
Paraffin Embedded Tissue: Human Kidney
Antibody Concentration: 5 ug/ml
Image 2
Human HeLa
WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Image 3
Human H9 cells, Human H9 cells + Na + Butyrate
Researcher: Dr. Ade Kallas, University of tartu
Application: Flow Cytometry
Species + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+Butyrate
Primary antibody dilution: 2ug+1x106 cells
Secondary antibody: Chicken anti rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:1000
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com