Product Number |
ARP39552_P050 |
Product Page |
www.avivasysbio.com/sox17-antibody-middle-region-arp39552-p050.html |
Name |
SOX17 Antibody - middle region (ARP39552_P050) |
Protein Size (# AA) |
414 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
64321 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SRY (sex determining region Y)-box 17 |
Description |
|
Alias Symbols |
VUR3 |
Peptide Sequence |
Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Zhang,W., (2008) Cancer Res. 68 (8), 2764-2772 |
Description of Target |
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
Protein Interactions |
CTNNB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SOX17 (ARP39552_P050) antibody |
Blocking Peptide |
For anti-SOX17 (ARP39552_P050) antibody is Catalog # AAP39552 (Previous Catalog # AAPP23082) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SOX17 |
Uniprot ID |
Q9H6I2 |
Protein Name |
Transcription factor SOX-17 |
Publications |
Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296 |
Protein Accession # |
NP_071899 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022454 |
Tested Species Reactivity |
Human |
Gene Symbol |
SOX17 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig |
Application |
WB, IHC, FC |
Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86% |
Image 1 | Human Kidney
| Rabbit Anti-SOX17 Antibody Catalog Number: ARP39552 Paraffin Embedded Tissue: Human Kidney Antibody Concentration: 5 ug/ml |
|
Image 2 | Human HeLa
| WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate |
|
Image 3 | Human H9 cells, Human H9 cells + Na + Butyrate
| Researcher: Dr. Ade Kallas, University of tartu
Application: Flow Cytometry
Species + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+Butyrate
Primary antibody dilution: 2ug+1x106 cells
Secondary antibody: Chicken anti rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:1000 |
|