| Product Number |
ARP39550_T100 |
| Product Page |
www.avivasysbio.com/tfb2m-antibody-c-terminal-region-arp39550-t100.html |
| Name |
TFB2M Antibody - C-terminal region (ARP39550_T100) |
| Protein Size (# AA) |
396 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
64216 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transcription factor B2, mitochondrial |
| Alias Symbols |
Hkp1, mtTFB2 |
| Peptide Sequence |
Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Falkenberg,M., (2002) Nat. Genet. 31 (3), 289-294 |
| Description of Target |
TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity. |
| Protein Interactions |
UBC; FBXO6; C1QBP; CUL3; TFB2M; POLRMT; TFAM; PNP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFB2M (ARP39550_T100) antibody |
| Blocking Peptide |
For anti-TFB2M (ARP39550_T100) antibody is Catalog # AAP39550 (Previous Catalog # AAPP21564) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TFB2M |
| Uniprot ID |
Q9H5Q4 |
| Protein Name |
Dimethyladenosine transferase 2, mitochondrial |
| Protein Accession # |
NP_071761 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_022366 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFB2M |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-TFB2M Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T |
|
|
