BACH2 Antibody - middle region (ARP39513_P050)

Data Sheet
 
Product Number ARP39513_P050
Product Page www.avivasysbio.com/bach2-antibody-middle-region-arp39513-p050.html
Name BACH2 Antibody - middle region (ARP39513_P050)
Protein Size (# AA) 841 amino acids
Molecular Weight 93kDa
NCBI Gene Id 60468
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name BTB and CNC homology 1, basic leucine zipper transcription factor 2
Description
Alias Symbols IMD60, BTBD25
Peptide Sequence Synthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hong,S.W., (2008) Biochem. Biophys. Res. Commun. 365 (3), 426-432
Description of Target BACH2 belongs to the bZIP family. It is a transcriptional regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coordinating transcription activation and repression by MAFK.
Protein Interactions BATF3; MAFF; NFE2L3; NFE2L1; MAFG; DDIT3; COPS6; SUMO1; UBC; ARRB1; NCOR2; PATZ1; MAFK; BCL6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BACH2 (ARP39513_P050) antibody
Blocking Peptide For anti-BACH2 (ARP39513_P050) antibody is Catalog # AAP39513 (Previous Catalog # AAPP23070)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BACH2
Uniprot ID Q9BYV9
Protein Name Transcription regulator protein BACH2
Publications

TBL1XR1 Mutations Drive Extranodal Lymphoma by Inducing a Pro-tumorigenic Memory Fate. Cell. 182, 297-316.e27 (2020)

Sample Type Confirmation

BACH2 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_068585
Purification Affinity Purified
Nucleotide Accession # NM_021813
Tested Species Reactivity Human
Gene Symbol BACH2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human Tonsil
Human Tonsil
Image 2
Human 293T
WB Suggested Anti-BACH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysateBACH2 is supported by BioGPS gene expression data to be expressed in HEK293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com