OVOL2 Antibody - middle region (ARP39500_P050)

• Product Number: ARP39500_P050
• Name: OVOL2 Antibody - middle region (ARP39500_P050)
• Protein Size (# AA): 275 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 58495
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ovo-like 2 (Drosophila)
• Alias Symbols: CHED, CHED1, CHED2, PPCD1, ZNF339, EUROIMAGE566589
• Peptide Sequence: Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Li,B., (2002) Genomics 80 (3), 319-325
• Description of Target: OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
• Protein Interactions: BAG3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OVOL2 (ARP39500_P050) antibody is Catalog # AAP39500 (Previous Catalog # AAPP23065)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OVOL2
• Uniprot ID: Q9BRP0
• Protein Name: Transcription factor Ovo-like 2
• Protein Accession #: NP_067043
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021220
• Tested Species Reactivity: Human
• Gene Symbol: OVOL2
• Predicted Species Reactivity: Human
• Application: WB, IF
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: RPMI-8226, U937
  
  Host: Rabbit
  Target: OVOL2
  Positive control (+): RPMI-8226 (N12)
  Negative control (-): U937 (N31)
  Antibody concentration: 2ug/ml
• Image 2: Human 721_B
  
  WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 721_B cell lysate