OVOL2 Antibody - N-terminal region (ARP39499_P050)

Data Sheet
 
Product Number ARP39499_P050
Product Page www.avivasysbio.com/ovol2-antibody-n-terminal-region-arp39499-p050.html
Name OVOL2 Antibody - N-terminal region (ARP39499_P050)
Protein Size (# AA) 275 amino acids
Molecular Weight 30 kDa
NCBI Gene Id 58495
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ovo-like 2 (Drosophila)
Alias Symbols CHED, CHED1, CHED2, PPCD1, ZNF339, EUROIMAGE566589
Peptide Sequence Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,B., (2002) Genomics 80 (3), 319-325
Description of Target OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
Protein Interactions BAG3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-OVOL2 (ARP39499_P050) antibody
Blocking Peptide For anti-OVOL2 (ARP39499_P050) antibody is Catalog # AAP39499 (Previous Catalog # AAPP23064)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OVOL2
Uniprot ID Q9BRP0
Protein Name Transcription factor Ovo-like 2
Protein Accession # NP_067043
Purification Affinity Purified
Nucleotide Accession # NM_021220
Tested Species Reactivity Human
Gene Symbol OVOL2
Predicted Species Reactivity Human, Mouse, Cow, Dog, Horse
Application IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%
Image 1
Human Corneal Endothelium
WB Suggested Anti-Ovol2 Antibody
Primary dilution: 1:250 ug/ml
Positive Control: Human Corneal Endothelium
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com