NR2F2 Antibody - C-terminal region (ARP39466_T100)

Data Sheet
 
Product Number ARP39466_T100
Product Page www.avivasysbio.com/nr2f2-antibody-c-terminal-region-arp39466-t100.html
Name NR2F2 Antibody - C-terminal region (ARP39466_T100)
Protein Size (# AA) 414 amino acids
Molecular Weight 46kDa
NCBI Gene Id 7026
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear receptor subfamily 2, group F, member 2
Alias Symbols ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII
Peptide Sequence Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sato,Y., et al., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Description of Target NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Protein Interactions NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR2F2 (ARP39466_T100) antibody
Blocking Peptide For anti-NR2F2 (ARP39466_T100) antibody is Catalog # AAP39466 (Previous Catalog # AAPP21480)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NR2F2
Uniprot ID P24468
Protein Name COUP transcription factor 2
Publications

Cho, K., Yi, H., Tserentsoodol, N., Searle, K. & Ferreira, P. A. Neuroprotection resulting from insufficiency of RANBP2 is associated with the modulation of protein and lipid homeostasis of functionally diverse but linked pathways in response to oxidative stress. Dis. Model. Mech. 3, 595-604 (2010). 20682751

Protein Accession # NP_066285
Purification Protein A purified
Nucleotide Accession # NM_021005
Tested Species Reactivity Human
Gene Symbol NR2F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-NR2F2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com