KLHL5 Antibody - N-terminal region (ARP39220_P050)

• Product Number: ARP39220_P050
• Name: KLHL5 Antibody - N-terminal region (ARP39220_P050)
• Protein Size (# AA): 709 amino acids
• Molecular Weight: 79kDa
• NCBI Gene Id: 51088
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Kelch-like 5 (Drosophila)
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Description of Target: The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family were cytoskeletal proteins implicated in various cellular processes, such as actin cytoskeleton interaction, cytoplasmic sequestration of transcription factors and cell morphology. During the large-scale sequencing analysis of a human fetal brain cDNA library we found a novel kelch-like protein gene 5, KLHL5, KLHL5 has high identity with Drosophila kelch protein and many other family members. A novel splicing variants of KLHL5, named KLHL5b and the expression pattern of KLHL5b in many tissues.
• Protein Interactions: FUS; CUL3; UBC; MAP1LC3B; GABARAPL2; TK1; SMN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KLHL5 (ARP39220_P050) antibody is Catalog # AAP39220 (Previous Catalog # AAPY00832)
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human KLHL5
• Uniprot ID: Q96PQ7
• Protein Name: Kelch-like protein 5
• Publications:

  Nagalla, S. et al. Platelet microRNA-mRNA coexpression profiles correlate with platelet reactivity. Blood 117, 5189-97 (2011). 21415270

• Protein Accession #: NP_001007076
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001007075
• Tested Species Reactivity: Human
• Gene Symbol: KLHL5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 75%
• Image 1: Human HeLa
  
  WB Suggested Anti-KLHL5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Hela cell lysate