Zbtb7a Antibody - C-terminal region (ARP39212_P050)

• Product Number: ARP39212_P050
• Name: Zbtb7a Antibody - C-terminal region (ARP39212_P050)
• Protein Size (# AA): 569 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 16969
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger and BTB domain containing 7a
• Alias Symbols: L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik
• Peptide Sequence: Synthetic peptide located within the following region: PPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Zbtb7a plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Zbtb7a specifically represses the transcription of the CDKN2A gene. Zbtb7a efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Zbtb7a binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
• Protein Interactions: Sox9; ZBTB7B; Cdkn2a;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Zbtb7a (ARP39212_P050) antibody is Catalog # AAP39212
• Uniprot ID: O88939
• Protein Name: Zinc finger and BTB domain-containing protein 7A
• Protein Accession #: NP_034861
• Purification: Affinity Purified
• Nucleotide Accession #: NM_010731
• Tested Species Reactivity: Mouse
• Gene Symbol: Zbtb7a
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
• Image 1: Mouse Pancreas
  
  WB Suggested Anti-Zbtb7a Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Pancreas