ZSCAN12 Antibody - N-terminal region : HRP (ARP39130_P050-HRP)

Data Sheet
 
Product Number ARP39130_P050-HRP
Product Page www.avivasysbio.com/zscan12-antibody-n-terminal-region-hrp-arp39130-p050-hrp.html
Name ZSCAN12 Antibody - N-terminal region : HRP (ARP39130_P050-HRP)
Protein Size (# AA) 604 amino acids
Molecular Weight 66kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 9753
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name zinc finger and SCAN domain containing 12
Alias Symbols ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2
Peptide Sequence Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Interactions KRTAP10-1; SSX2IP; ZNF496; CEP70; ZKSCAN7; ZSCAN32; ZNF473; TFIP11; MTUS2; MID2; ZSCAN12; SUMO1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ZSCAN12 (ARP39130_P050-HRP) antibody
Blocking Peptide For anti-ZSCAN12 (ARP39130_P050-HRP) antibody is Catalog # AAP39130
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Uniprot ID O43309
Protein Name zinc finger and SCAN domain-containing protein 12
Protein Accession # NP_055539
Purification Affinity purified
Gene Symbol ZSCAN12
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com