NT5C Antibody - C-terminal region (ARP39112_P050)

Data Sheet
 
Product Number ARP39112_P050
Product Page www.avivasysbio.com/nt5c-antibody-c-terminal-region-arp39112-p050.html
Name NT5C Antibody - C-terminal region (ARP39112_P050)
Protein Size (# AA) 201 amino acids
Molecular Weight 23kDa
NCBI Gene Id 30833
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 5', 3'-nucleotidase, cytosolic
Alias Symbols DNT, cdN, DNT1, P5N2, PN-I, HEL74, PN-II, UMPH2, dNT-1
Peptide Sequence Synthetic peptide located within the following region: QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene.
Protein Interactions UBC; NT5C;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NT5C (ARP39112_P050) antibody
Blocking Peptide For anti-NT5C (ARP39112_P050) antibody is Catalog # AAP39112
Uniprot ID Q8TCD5
Protein Name 5'(3')-deoxyribonucleotidase, cytosolic type
Sample Type Confirmation

NT5C is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_055410
Purification Affinity Purified
Nucleotide Accession # NM_014595
Tested Species Reactivity Human
Gene Symbol NT5C
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human 721_B
WB Suggested Anti-NT5C Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellNT5C is supported by BioGPS gene expression data to be expressed in 721_B
Image 2
Human Placenta
Rabbit Anti-NT5C antibody
Catalog Number: ARP39112_P050
Paraffin Embedded Tissue: Human Placenta cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com