BRD4 Antibody - C-terminal region : FITC (ARP39076_P050-FITC)

Data Sheet
 
Product Number ARP39076_P050-FITC
Product Page www.avivasysbio.com/brd4-antibody-c-terminal-region-fitc-arp39076-p050-fitc.html
Name BRD4 Antibody - C-terminal region : FITC (ARP39076_P050-FITC)
Protein Size (# AA) 722 amino acids
Molecular Weight 80kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 23476
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Bromodomain containing 4
Alias Symbols CAP, MCAP, HUNK1, HUNKI
Peptide Sequence Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Schweiger,M.R., (2006) J. Virol. 80 (9), 4276-4285
Description of Target BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
Protein Interactions AFF1; CDK9; CCNT1; STAT3; JMJD6; TCERG1; HEXIM1; RN7SK; PRPF40A; vif; RPL6; MYC; MLLT1; ELAVL1; SUMO2; UBC; YWHAZ; KAT8; C8orf33; MESDC2; HIST1H4A; HIST1H3A; YWHAE; MED1; EP300; KDM5B; C7orf25; CHFR; CLDN1; RFC1; RFC4; HIST2H3C; HIST2H4A; MED12; MED24; ME
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-BRD4 (ARP39076_P050-FITC) antibody
Blocking Peptide For anti-BRD4 (ARP39076_P050-FITC) antibody is Catalog # AAP39076 (Previous Catalog # AAPS05411)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
Uniprot ID O60885-2
Protein Name Bromodomain-containing protein 4
Protein Accession # NP_055114
Purification Affinity Purified
Nucleotide Accession # NM_014299
Gene Symbol BRD4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application CHIP, IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com