HBP1 Antibody - middle region (ARP38977_P050)

• Product Number: ARP38977_P050
• Name: HBP1 Antibody - middle region (ARP38977_P050)
• Protein Size (# AA): 514 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 26959
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: HMG-box transcription factor 1
• Alias Symbols: FLJ16340
• Peptide Sequence: Synthetic peptide located within the following region: SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Paulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145
• Description of Target: HBP1 is a transcriptional repressor that binds to the promoter region of target genes. This protein plays a role in the regulation of the cell cycle and of the Wnt pathway. It binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter, HBP1 is enhanced by interaction with RB1. The protein also can disrupt the interaction between DNA and TCF4.
• Protein Interactions: FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HBP1 (ARP38977_P050) antibody is Catalog # AAP38977 (Previous Catalog # AAPS05408)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HBP1
• Uniprot ID: O60381
• Protein Name: HMG box-containing protein 1
• Publications:

  Li, H., Bian, C., Liao, L., Li, J. & Zhao, R. C. miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1. Breast Cancer Res. Treat. 126, 565-75 (2011). 20505989

  Wang, W., Pan, K., Chen, Y., Huang, C. & Zhang, X. The acetylation of transcription factor HBP1 by p300/CBP enhances p16INK4A expression. Nucleic Acids Res. 40, 981-95 (2012). 21967847

• Sample Type Confirmation:

  HBP1 is supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_036389
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012257
• Tested Species Reactivity: Human
• Gene Symbol: HBP1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human HeLa
  
  WB Suggested Anti-HBP1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Hela cell lysateHBP1 is supported by BioGPS gene expression data to be expressed in HeLa
• Image 2: HeLa Cell Lysate, 293T Cell Lysate
  
  Host: Rabbit
  Target: HBP1
  Positive control (+): HeLa Cell Lysate (HL)
  Negative control (-): 293T Cell Lysate (2T)
  Antibody concentration: 0.5ug/ml