TRIM32 antibody - C-terminal region (ARP38966_T100)
Data Sheet
 
Product Number ARP38966_T100
Product Page www.avivasysbio.com/trim32-antibody-c-terminal-region-arp38966-t100.html
Product Name TRIM32 antibody - C-terminal region (ARP38966_T100)
Size 100 ul
Gene Symbol TRIM32
Alias Symbols BBS11, HT2A, LGMD2H, TATIP
Protein Size (# AA) 653 amino acids
Molecular Weight 72kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22954
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tripartite motif containing 32
Description This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Target Reference Chiang,A.P., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (16), 6287-6292
Description of Target TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Protein Interactions PTPN11; PDE9A; PTCD2; CLIP4; KCTD9; UBQLN1; TRIM32; RABAC1; ABI2; SCGB1A1; UBE2E1; UBE2D1; UBC; TP53; SDCBP; UBE2U; SYT6; MYCN; CEP250; CUL3; GPRASP2; GLIS2; YWHAB; TP73; UBE2D3; UBE2D2; HSP90AA1; SFN; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; NOTCH1; UBD; TOP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: Transfected 293T cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TRIM32 (ARP38966_T100) antibody is Catalog # AAP38966 (Previous Catalog # AAPY00775)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM32
Complete computational species homology data Anti-TRIM32 (ARP38966_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TRIM32.
Swissprot Id Q13049
Protein Name E3 ubiquitin-protein ligase TRIM32
Sample Type Confirmation

TRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_036342
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TRIM32.
Nucleotide Accession # NM_012210
Replacement Item This antibody may replace item sc-134120 from Santa Cruz Biotechnology.
Conjugation Options

ARP38966_T100-FITC Conjugated

ARP38966_T100-HRP Conjugated

ARP38966_T100-Biotin Conjugated

CB Replacement sc-134120; sc-135588; sc-49265; sc-49266; sc-61714; sc-61715; sc-99011
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Image 1
Human Muscle
Human Muscle
Image 2
Human 293T
WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/ml
Positive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T
Image 3
Human A549 Whole Cell
Host: Rabbit
Target Name: TRIM32
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com