ARID3B Antibody - C-terminal region (ARP38798_P050)

Data Sheet
 
Product Number ARP38798_P050
Product Page www.avivasysbio.com/arid3b-antibody-c-terminal-region-arp38798-p050.html
Name ARID3B Antibody - C-terminal region (ARP38798_P050)
Protein Size (# AA) 560 amino acids
Molecular Weight 61kDa
NCBI Gene Id 10620
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name AT rich interactive domain 3B (BRIGHT-like)
Alias Symbols BDP, DRIL2
Peptide Sequence Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kortschak,R.D., (2000) Trends Biochem. Sci. 25 (6), 294-299
Description of Target ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Protein Interactions SOX2; APP; TINF2; POT1; UBC; IRF9; MEPCE; CDK9; RB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARID3B (ARP38798_P050) antibody
Blocking Peptide For anti-ARID3B (ARP38798_P050) antibody is Catalog # AAP38798 (Previous Catalog # AAPP21007)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3B
Uniprot ID O95443
Protein Name AT-rich interactive domain-containing protein 3B
Sample Type Confirmation

ARID3B is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006456
Purification Affinity Purified
Nucleotide Accession # NM_006465
Tested Species Reactivity Human
Gene Symbol ARID3B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ARID3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateARID3B is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com