| Product Number |
ARP38730_P050 |
| Product Page |
www.avivasysbio.com/hdac6-antibody-c-terminal-region-arp38730-p050.html |
| Name |
Hdac6 Antibody - C-terminal region (ARP38730_P050) |
| Protein Size (# AA) |
1149 amino acids |
| Molecular Weight |
126kDa |
| NCBI Gene Id |
15185 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Histone deacetylase 6 |
| Alias Symbols |
Hd6, Sfc, Sfc6, mHDA, Hdac5, mHDA2 |
| Peptide Sequence |
Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. |
| Protein Interactions |
Hdac11; Ubc; Hsp90ab1; Park2; TARDBP; Vcp; USP47; HDAC6; PLAA; GARS; Tuba1a; Rela; Nfkb1; Mapt; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Hdac6 (ARP38730_P050) antibody |
| Blocking Peptide |
For anti-Hdac6 (ARP38730_P050) antibody is Catalog # AAP38730 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6 |
| Uniprot ID |
Q9Z2V5 |
| Protein Name |
Histone deacetylase 6 |
| Protein Accession # |
NP_034543 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010413 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Hdac6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB, CHIP, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86% |
| Image 1 | Mouse Testis
 | WB Suggested Anti-Hdac6 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Testis |
|
| Image 2 | HCT116
 | Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region (ARP38730_P050) and HCT116 Cells |
|
| Image 3 | heart
 | Rabbit Anti-Hdac6 Antibody
Catalog Number: ARP38730_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 4 | Mouse Spleen
 | Host: Mouse
Target Name: HDAC6
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml |
|
